PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462930540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 442aa    MW: 50415.2 Da    PI: 9.278
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462930540genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3382.9e-12531381598
                -EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3  15 rlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                 + +p kf++++      ++  +++ + t+  ++g+++++kl  +  +   ++t GW++ v  +g+ke D+++F+++g+++f  +vk+f 
  462930540  53 KMLIPAKFVKQYfpkehmSSCMATGCMATVLGPHGKVYSIKL--EMDRLDLFFTCGWSQLVAFHGIKEYDSLLFRYEGNTCF--TVKLFG 138
                478888888888766555333336679***************..888888********************************..888875 PP

2B341.32.7e-13200275986
                HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                 +l+++ l l   f + +g+ +++ ++l+    s +sW v    +k +  y+l +GW+ F+++n LkegDf +F +++
  462930540 200 ETLERH-LALATAFSDGIGLREPCMIELKTSMDSVKSWPVHGLPWKER-NYLLVEGWRTFCQENSLKEGDFYIFNVIN 275
                455555.8889999988999999987777777777*******778886.69999********************9775 PP

3B350.53.8e-16346428285
                EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
         B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                +k++++  + k+ rl+l+  f+e++g+ +++++tl+   +s rsW+ ++   ++ + ++ + GW +F+++ng+k+gD+++F  +
  462930540 346 IKKEINTCAIKN-RLYLSQVFCEAIGIREACTITLKTSMSSTRSWQARILPYGYCSNHIVGPGWTRFCHENGIKVGDVCTFNII 428
                566666666665.6**************99988888888999*******88999999************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.4E-1738142IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.33E-1839142IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.739140IPR003340B3 DNA binding domain
CDDcd100175.11E-1450137No hitNo description
SMARTSM010192.4E-951140IPR003340B3 DNA binding domain
PfamPF023621.6E-1053137IPR003340B3 DNA binding domain
SuperFamilySSF1019361.35E-13189285IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.068191287IPR003340B3 DNA binding domain
SMARTSM010190.017193287IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-14194285IPR015300DNA-binding pseudobarrel domain
CDDcd100172.04E-7196271No hitNo description
PfamPF023625.3E-10206283IPR003340B3 DNA binding domain
PROSITE profilePS5086310.405344441IPR003340B3 DNA binding domain
SuperFamilySSF1019368.04E-15345437IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.2E-4346441IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.5E-16348437IPR015300DNA-binding pseudobarrel domain
CDDcd100173.41E-10353425No hitNo description
PfamPF023621.5E-12356429IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MAGTKWTPLP RASSESGLQP QARASPHENT RSSKGAIRKP HFICHLAKDF MEKMLIPAKF  60
VKQYFPKEHM SSCMATGCMA TVLGPHGKVY SIKLEMDRLD LFFTCGWSQL VAFHGIKEYD  120
SLLFRYEGNT CFTVKLFGPE GCQRECERME IRVQQKSGKQ QEAPSASIWK DRCRNKASSG  180
RNYAYEIGTP SWIMKRISTE TLERHLALAT AFSDGIGLRE PCMIELKTSM DSVKSWPVHG  240
LPWKERNYLL VEGWRTFCQE NSLKEGDFYI FNVINTTLWH VVIKRCEEQM NHLCYETPSA  300
SNRKHMSKYN GSGDEGQKKP KDSMTVLNKT SSKKRGIFEI GPKAWIKKEI NTCAIKNRLY  360
LSQVFCEAIG IREACTITLK TSMSSTRSWQ ARILPYGYCS NHIVGPGWTR FCHENGIKVG  420
DVCTFNIIEP TLWHVVITPQ IS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A9S1931e-179A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi010026m6e-82(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.12e-15B3 family protein